Dataset for protein BCL-2-like of organism Rattus norvegicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                     :  .       
--------------------------------------------------------msqt-----dnrelvvdylsykLs
mfglrrnaviglnlycggaslgagggspagtrslfglcqyrsyiyvslsslplsrv-amsprtgy-thsiamkfihrvar
                               mlaaeeakafregggeaal  gaaav-aagpstpyipavtanavqfl q
                                                        rmrpdcefmrd r les eg c k
                                                           g avqde  d  t   r    
                                                              l a          l    
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qkgy-wsqpsdve-------ap--------pe-----a---------------vgaagpssspda------aavh-----
vpafsedafdedsenrteim--eetifsfe--retps-ingnpswrlsdspavn--t-h---l-previpm---khqsle
srnte---g----aplra  s tpgldgcq  snrtppvhrdtaahtaplrpl-at- -alg-v-ppeeedpvl-     
a  lpavt-tkta sag       e       vlsmr avlpmle v eaaksscgd sge ta       dp y     
    l pp esm    a                 pk      l            n   lp  p        e       
       l  a                                                                     
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                               .:              :     .               :          
------------------------------qalrragdeferryrrafsdltsqlhitp-gtarqsFeqVveelFrdGv-
iisrylreqatgskdakplgeagaagrralltmqevafsvslevekdlaemsrdfqvesifsvygraatlmnkeqeg-pi
                              rv lasvtdqqtqfhtt kpyldkydlnrleldqii tr sdnv q- it
                              e       g iknh qn qnsaa   gkn dd vkm ne lthd k  -f
                              a          q e    fg f           t   s   s        
                                                                   d            
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****:* :: * . :                          :   :   :      *:    **                
NWGRiVaffsFGgalc--------vesvnkemqplvd---riaswmatylnrhlepWiqenGGW-dgftelyg---p---
    l tlle vavmlnqdrtvkrkklpdrqisvdrstykqvslfvtefimdrtht lhdsr  evrtvpkfcnpldgal
      miia   tvm        ardqqerqeleigc  nlqdslvnv etnkrd  vsq    aa ckfve   vqd 
         v   f a        rh ksnnllsc e   p veliydr vnthge  eqh     e  a  k   n   
                         g  ri  g       l         tg  as   k      t  q  h       
                                a                          a         d          
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---r-l----w-s--t-l-pgmwvgalvtlGailgsk-------------------------------------------
esm-r-ssvs-p-lp-w-tslavlediiyvrdypahlflpkvnygniddpvfkepvffilatlvapqfhsfvpisrqrkt
 plvpnfdfeilnckflslksvlrtgcdms kffsmtlilgqhfiwkcl                               
 eaiceregnqarvrrvf gagafafvq-t slweffirtaif                                     
 ngaa  rkg e fn    v lt rl -li  g  y  a                                         
 g                 t f     ag      r                                            
                                   c                                            

         
....:....
         
---------
acvftwlkt
         
         
         
         
         
© 1998-2019