Dataset for protein Bcl-xL of organism Rattus norvegicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************   . *     .. *     .   *  .**.* .:   *.: .         
VLVSRIASWMATYLNDHLEPWIQENGGWvrttpLvcpplvclSsveipncpfWs-pGMvVedidysGdipgft-------
                            dtfvd ygnnaaae rkgqerfnr flt  t agvvll slfssllipgvnf
                                                                       rk       

       250       260       270       280     
....:....|....:....|....:....|....:....|....:
                                             
---------------------------------------------
gniddpvfkepvffilatlvapqfhsfvpisrqrktacvftwlkt
                                             
© 1998-2019