Dataset for protein Bfl1 of organism Rattus norvegicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSRVLQRVAFSVQKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFE
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************.***************************************************
DGIINWGRIVTIFAFGGVLLKKLPQEQIgLDVDTYKQVSSFVAEFIMNNTGEWIQQNGGWEDGFTKKFEPKSGWLTFLQM
                            a                                                   

       170     
....:....|....:
***************
TGKIWEMLFLLKQHY
               
© 1998-2019