Dataset for protein Bcl-2 of organism Rattus norvegicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******************************:** *:*** ***************  ****** ************.**
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDtGDeDsAPLrAAPTPGIFSFQPESNrtPAVHRDtAARTSPLRPLVAtAG
                               a  a a   g               pm      m            n  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**************************************************************************** ***
PALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVeSVN
                                                                            g   

       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
****************************************************************************
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
                                                                            
© 1998-2019