Dataset for protein BCL-2-like of organism Pundamilia nyererei

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   :                                 .  .  .      .             
---eqnr--vrkyiryklsqrtlvly-iv-ne------g-----d-pqylvtsctstsngpvppstpasp-rl-q--p--
mcr----nlmlnmmmlgrwkenypwnl--v--vsnrtn-yitgn-septithrsrgshtatssntptkr-r--q-ts-st
 ansysdiigef kfh  n cgfmeghrpqqgplegpmhsgs lsp drasghanepfq ipgggnshlcqnrpvsptng
  m    ea a   cc         af  l  edaand gaa   e  n dfc kda    d e e  a d  e qd ha

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                             .:.    :.   :   :  
----ai-------------------------------------------------------amrrvgweverryqyaftn
yktk--rdreedgslpstpefhsdsesdeqleretkllihsflgdftglsqpqrketkalrvlketvndlllqhrrrysg
tdldgvk                                                     kt  dlad i el apd ne
      h                                                     e    a a f  k  a  dd

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:   : :         .  * ..:. *   ****::.:: * ..:.    .:    .                : : :: 
mssqlhltsatay-ssfrnVmkelfrDg-vNWGRivslfaFggvvcvecveke-gmsp-----------yvrriaewmtv
lirtfsvqprpeqmrrvgk idsvvg htt    vigfme tatlsrkllsq-p-rdsgqqqelgqepmscgnvvqtise
 hqk lidegddhcqflee a       hl      a      a aqhik nk  l n           q dllsde ad
 an     c   d l  aa                              a                   l a       a

       250       260       270       280       290       300    
....:....|....:....|....:....|....:....|....:....|....:....|....
**    . *: .:..*: * ::            :          .      :     :     
YLnseqrdWiqdnggWegFveffr-sdresvvrsswpsfktwfgvgatgaaglt-gayllqk--
  lnplqs lvsqna dr cklygvrqpdvsssrtqm--akvlllamvvvtsvvi--lit--rl
  gghknp  lk   a a isd qaaaaiqdh mkai glaai gllllliscwdf avr  
  de ik                  a    ef c le   af  a         a  a      
© 1998-2019