Dataset for protein Mcl-1 of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :  *.*.: ** *.** .  *                                                     
mfglkrnavIgLnlyCGgAgLGagssGatppggrll--------------------------------------------
------dlw n gis  r d  wawl l--------aaekeatarrevgggedgtviggspgasppasltpearrvarpa
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pigaevpdvtatperllffaptrralpseemeapaadaimspedeldgyepeplgkrpavlpllelvgeasngsstdgsl
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                 .**** :        
-----------------------------atgakdakpmgrsgaasrkaletlrrvgdgvqrnhetAFQGmlrkldikne
pstpppaeeeddelyrqsleiisrylreq------------------------------------k    wvq-------
                                                                        c       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                               .: ..  .  .::.*   :. .           *             : 
ddvkslsrvmvhvfsdgvtnwgrivtlisfgafvakhlksinqesCieplaesitdvlvrtkrdWl--qrgwdgfveffh
------------------------------cvlpsrgprt-rhqk aagfcrcc---------- -vk---------kia
                s                                   i           s s f isn   

       330       340       350
....:....|....:....|....:....|
:                             
vedleggirnvllafagvagvgaglaylir
l-----------------------------
      s                  t    
© 1998-2019