Dataset for protein BCL-2-like of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------t-pdtrrlvadylgyklr--g--------------------------va---
mfglkrnaviglnlycggaglgamstga-p----l-aiefvatc--qv-ygwdgtviggspgasppasltpearrgpgde
                      mgmsprsfggnhei---le--arsep gvesqyidaegnrtgaagatptqmmtas   
                       aagdcmayygeaawvnk-ss-tavk  sqk f c aea ee  edplspgif--   
                        ha  fsqsk - lqk-nq v   r  ec       d   a    aeh  gas    
                            erer  n  mg il                               e r    
                             g l  d     gi                                 q    
                                         h                                 p    
                                         e                                      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
fetrfrrtfsdlaaqlhvtpgsaqqrpapigaevpdvtatperllffaptrralpseemeapaadaimspedwmvaylet
                          ftqvsd lfqggpnwg  va fvfga  ca svnkemeplvgqvqe        
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------------glgrsslei------
rladwiheldgyepeplgkrpavlpllelvgeasnlkelgsstdgslpstpppaeeepvimsidde-ypqpssaisrypr
       ssg w l aika      vr mee  ek    qnevekqmnms   gnag      ee-s-ana-plyppslp
                                                                 qpp-a-tg-tvgnvd
                                                                 kmnw-wr-rladgga
                                                                 dieggkpwha  d  
                                                                 ae  d d        
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------tlrrag-------------dgvqrr---herafqgmlsklhitpgdavqs-fsrvm
eqatgakdakpmgrsgaasrkaleamkfvahpkgfayiefsdk-sfrtnlalyrttwsdlvrq-d-knetdykrileq-v
artstppssalgpgpvsvppvvhq------             te-e--   --srlraytq-v-v-------- ---m-
yngapghleshfhaesppnaatklvqqqt              l-p-ns   vnkn kpwspnmslyspsyryy stvis
ll  aeea  ada c i m   iamd ns              frislk   la l aerqil nthlinrqrt  qt p
 g                      c  ei              ek  ke   f  f   pag  a cffl ill  n  a
                           a                d       d  d   c d    a    ag   a   
                                                             c                  
                                                             a                  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
vevfrdgvn-wgrivtlfsfggflckesvrke-------mqplv-------------laewmtdylvrtlrdWiq-nggw
ehl-s-sitn-----afi---aavavhlksiniwwqescyev--srgdpevardrqrivtsia---n-hk---l-ksr--
n--n-p--st   v ---v c--tsrgppn-raalkvwtisscttn           ysylr-tvi-d--ep -veq-sy
-rtlqg p-    l mvvt avvplergrdvt   dkdgqrkrpkq           vqsflver ttrhht  rs- f 
kke e  lv         e   tmiakfltrq       lkeqigp           fnrcccai enqage  hq    
da  c             a   l d    pe        h a aeg            cl    f agn aa   d    
                      i       a             de             a               a    
                                            a                                   
                                                                                

       410       420       430       440       450    
....:....|....:....|....:....|....:....|....:....|....
                                                      
d-gfvelfgvedle----------------rvlltfagvagvvtlgaylir---
-ht---fyhp-a--esrrgrerfngswrslnwf-agmt----gagl--f--kll
s -itskprnn-aagriklqplnwavil  -t-w--llsgal----sl-sys  
f e snrielsvyr ga    g dfgv   t-wvyv--ltfkilvvts wtr  
e a nk  akrmpl a              plstssvy c cactmlf ls   
a   cd   gpl                  ka  qlpe      d i  gh   
     a   dg                   a   ga a           a    
                                                      
                                                      
© 1998-2019