Dataset for protein Bcl-xL of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
msqsnrelvvdflsyklsqkgyswsqfidaeenrteapeatesemetpsaingnpswhladsppangatghsssldarev

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          * :*   : * .* :   .. :    ********************************************
--------mqKrtGlrpqlRyrRrwsppvsqmhttpGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
ipmaavkqal ea defek ln afrdltpllaihl                                            

       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
*************************************************************************
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                                                                         
© 1998-2019