Dataset for protein BCL-2-like of organism Poecilia mexicana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                :                          .                    
--------mysnrelvlfyisfkls-----qrnyssglw-------------------yst------vtvaetywngtss
mhrgspsmvwrcst------pysqngvgdggtkmpqshvvpnvppgstvdslhspkdprkqrptnlaeqtsrgnvhlslr
       astm   taen lkshia       h diq ll eeamda aagdaagdagmee      adglndhidkrfq
         sa         i              c  i                   kdd       aa    aa dcn

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .   .        *  .:    :                                          : .  :    .   
gpspgs--------Prrsqsa-aa-------------------------------------tvsvvkvvlrdvasefeyl
sthndplvnswpgt pqqepptptsavrasnqvldndtmelissflrhftglskcrwsqnkmrrtmqstvkqtqrrhrsr
ks da deg lacs gp ddesd                                      gmela r ee hlek hra
               ak  a                                         alda  d  a a a   l 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    ::                .  * :::. .*  ****:*.:.:*.. :.     .     .                
ytgslnhlsldl--tp-tayqsfttVmdelf-dG-vNWGRvVslfaFggalcv-cverqmshlvsr--------------
asrmfkrchtt-hi--p--msnvrn lenvvsk tt    i gmvt aavva-h---knrreqtglnpgpdsgkqqelqq
 qqf  d gsq d nqddncgflkk a  m r  hf      a      i  qelkq gle c ek              
 n a    a       a      ee      g                   d    e     a               

       250       260       270       280       290       300       310         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
       : : :: ** :.   *: .:..*: * .              . ::     : *:.     :        * 
-------iaewmttYLderqrpWlqsqngWdrFaey--gqraaaessrvretlvawllv-Giavltaflv-------R-
epvscravvktisv  lkqlnd vekngs eg vslay-gnvvsqgrtsqtsfnnvvgla vslvlglilvsivaqk l
       ls e ad  e nkk  iae       cni hnfdesdpe smknmkfa    mggt fa igmff k   
                  hie              f f a     d  f    k         a     a         
© 1998-2019