Dataset for protein BCL-2-like of organism Poecilia latipinna

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                :                                     .         
--------mysnrelvlfyisfkls-----qrnyssglw------------------------------rstvyvaetyw
mhrgspsmvwrcst------pysqngvgdggtkmpqshvvpevamgatvdslnsppdsykqrptnldvtmengqtlrsnq
       astm   taen lkshia       h diq ll            he k ptaagdaagaagkdeedg kdli
         sa         i              c  i                              a daa    ha

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     ..   .        *  .     :                                          : .  :   
rgtssgpspgp--------Prrsrsa-aa-------------------------------------tvsvvkvvlrdvas
nssfrstlnctlvnswags pqqqpptvtsavrasnqvldndtmeligsflrnftglskcrwsqnkmrrtmqrtvkqtqr
elddn sh as         gp edesp                                      gmkla l ee hle
d cce               ak da                                         alda  d  a a a

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .       ::                .  * :::. .*  ****:*.:.:*.. :.     .     .           
efeylytgslnhlsldl--tp-tayqsfttVmdelf-dG-vNWGRvVslfaFggalcv-cverqmshlvsr---------
rhrsrasrmfkrchtt-hi--p--msnvrn lqnvvsk tt    i gmvt aavva-h---knrreqtglnpgpdsgkq
k hra qqf  d gsq d nqddncgflkk a  m r  hf      a      i  qelkq gle c ek         
   l  n a    a       a      ee      g                   d    e     a          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            : : :: ** :.   *: .:..*: * .              . ::     :*:: :   :       
------------iaewmttYLderqrpWlqsqngWdrFaey--gqraaaessrvretlvawllvGvagltatla--i-a-
qelqqepvscravvqtisv  lkqlnd vekngs eg vslay-gnvvsqgrtsqtsfnnv--l msvvgglivvs-v-q
            li e ad  e nkk  iae       cni hnfdesdpe smknmkfag  li ff lgmfrkl
                       hie              f f a     d  f    k            a  fl f k

       330       340     
....:....|....:....|....:
                         
kr-----------------------
-sllgqqklntsllemrdctslepg
r a                      
                         
© 1998-2019