Dataset for protein BCL-2-like of organism Periophthalmus magnuspinnatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                             .                  
----------------------------------------------------------mslnrelvelyiqyklsqrntp
mniinspkrtalklstmglflpqnglaegdmhcgaadssdttprqgvmttrlgtthmsgpphprptafvmkne-lnkdcr
                                       aqmclpatldppk naasmsgswkntl kfesh- ------
                                                        icndc   i   a d    k gya
                                                         ac           c       f 
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                       .:    :.:
--lyensegslpctpn---dsemglssysvnr------------------tgisqprwsqrp-----aslsalrdsadel
eed---d--e-dte-efhs---le-gdrlaehevlesdtrqllsdffklsnscratklkpp-sdsls-ikttmkgvvnkf
ws-qms-pt-v---sd   tel--s-----d-ar qre evdstelrldf-rtpslvarla llppdgaarv trlgqdm
sgflllgldrrsvqr-   rdivvpnpvgt-                   lcn geqhcs- d hhadvhp   ea    
   hheagadiq an    kahna  gm                      a d   l a     da    e         
   g d    g   g    g a                                                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .   :  :   :              * ..:. **  ****: .:: *...:.     :                  
eerhsyafsglsrqlhltprtayvsf-gsVmdevfrDG-vNWGRivslfaFggvlcvecvtk---------------g-m
lllfrrryndminkfaiddagddqrsiet akslve  tt    vagfiv aaavaqylkeqkssrpgldpgqvqgleqr
 rkytqd ts hst ykqssp qr  lrk ii k  hl     ia  t   t srhiad                ddv
 aq qp  hn  q  l  cg  pn   ke      g             e          s                   
    ka   e     d   d   c   a                                                    
                                                                                

       250       260       270       280       290       300       310      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
     .:   :: **      *:  :..*  * ::   .       .          .    ..:     :  .  
sslveriaqwmtvYLdehirdWivsnggWagFveiygqeaaasavrste--kkwllaavtllagvvvgslllqr--
etccanvvteiss  lldqqt lqrqna dr adffrvddpeqsrhne-sf----fmgmggvtslgatlamaikrl
piq r lgnt ai  ngtlss  dn    vs cql---srhsvksdqwsrm tvfgv aa--itiltyisv   
  d p   d   e  g nka   le    ea     drqcdgrf c rptl  a  l  i a   lgamf  k   
    d       d    e      d             n   e    d  i              a  a       
                                                                            
© 1998-2019