Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   :                                            
-----------------------gstgatppggrllatdyl-yklr---------------g------------------
mfglkrnaviglnlycggaglga-mgprefgdtyrivaekvq----eigggqkgyvigatp-asppagltpdarrvarpp
                      mmapdcsayyi-a lq-fegsvrqqr yeeaatdcagga  a apaifssqpghtph 
                       ahal  rter -  mk--a a s     wd g g           ccare       
                        d    g  n e     ih                                      
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pigaevpdvtatpprplffaptrraapleemegpaadplmspeeeldgyepeplgkrpavlpllelvgesgnspstdgsl
aasrdpvar tplat                 a    ai                                         
          s e                                                                   
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                    :.     .              :     
------------------------------------------g-tsrkaletlrrvgdsvqrrhetafqgmlrqlhvtpi
pstpppaeeeedelyrqsleiiswylreqatgakdtkpmprs-a-p---hrvmqqaafgfetnyrrtlspladnvnlksg
                               stpeaaaigqpslv-svtsqa  klhre skev kn-kdcvak diane
                               a  a   g al pglpsvalr  a   d fsaf -- gywssr -----
                                                  a               d aepgng e val
                                                                        c      f
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 *   *                                                          
davrr-fsqvmeelfsdGp-nWgrivtlfvfggilc------------------kklvnqemeplvdtlae---wmteyl
stqqtlltr----v-qg vtt --l-afis-eafviereplvtawwkkrsfqpraesltkrqasdigqyqrisysvvsvi
-daks -n- svkeper iir   - -i-a --a-a                  -h-krinisrccepvkl   fiadf-
t----  -t vdh- rp  r    v s-v- a -m-                  v-e----vqk aqriva   llwa- 
m rgv  ad      c             t   v l                  l  qerdh    anfc    ccs r 
  ea                         e   t                         g       g            
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      *:                                                                        
vrtlrdWivsqggwd-fve------------r-------------------------------------l--wlgvagvg
mtrtge lrqnr--eg---kfhrvegleggi-plrelswlvslqqnpssppgnwktvipsipgmmvsns-sala--vpms
ennkat fqks-  -sefvfyg grdrleeaenvkrhqneleklmemlpagflegsadmgfeekleadarlvf-tt-ly-
----hs  h--   vntrttpy epemassm rrgdfg               aap             ktt-vsnmilt
ngqh a  -d    glgarllr  d a p k k f                                   rlytnllei 
a h      a    ak  iakf  a                                             kismdhid  
               a    a                                                  g h f a  
                                                                           a    

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
akiael--------------------------------------------------------------------------
-glty-lrllkkymsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfp
n-vvlsiahkhqkgal                                                                
gtaf-pvypgqlcc                                                                  
fn enmes f g                                                                    
 l c gal a                                                                      
 c                                                                              
                                                                                

       490       500       510       520    
....:....|....:....|....:....|....:....|....
                                            
--------------------------------------------
raryrarttnynssrsrfysgfnsrprgrvyrgrarvtswyssy
                                    agaffapk
                                            
                                            
                                            
                                            
                                            
© 1998-2019