Dataset for protein BCL-2-like of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------l--d---y-l------------------g-pg-gasptsr------
mfglkrnaviglnmydqwrgrtmmtdcefpytyr-va-ylq-v-rqngviglnlycggagdlpq--s-p-kp-gifssqp
             lvcggaelmaaapasagdiraiaqtfvgfkkqikayvcga  vwd   v-agspt-t-lh-      
                     gthsgrttyrnge lmkgimdgakrr        ec    p tspgasdt-gq      
                       g  plrepge      ak t smp              g reemdirrapa      
                          gag           h c pe                 ga a  c  le      
                                                               e     a  e       
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------alravgdevqrrvernfksmlaqlnvvsgdtvrsl-sq
ghtphpaasrdpvartsplqtpaapgaaagpalspvppvvhlvmqnaafsfske-rktlsecgdnvhitpvsdaktffnt
                                          --l---------y-igggdaarvidgkneaaqqrtatr
                                          tv-rtekvaltqrp--e--l--k-g-saf-spp-- l-
                                          r  qsyigreanfhtv-tt-ys-y-l---t---lm -s
                                             ef adh dii ss qgisml p nr elrg   d 
                                                 a    h pp fc hlg         a   a 
                                                         d c                    
                                                         a a                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                           :    
vmekvfsdg-pnwGriVtlf-fgg-l-k----------------l---q--p---tvkplaewvteflvtrtrdwlvqqg
psshlve--vtpi-al----s--ai-i-kgplvttrwkkwgfqp-lnq-tinqvslyeeisysmadyimrtlaepirknr
-diee-qrpii-- -e aiia e-fvcah               svrkkma-dedditqvqaflvfvapnnkga  qsse
 -drrpag  -t   -  fvv a amave               r  reiedvarc-gatp-rila--e-vrht  hems
 v--- -   v    v    t   v ler                  e es    -c----l----r -gqh s  eaa 
 l ds r             e   t                         g      qr v l ss  n ha    td  
      g                                                  dn                     
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
gwd-----------------------------------------------------------------------------
apeadaimspeeeldgyepeplgkrpavlpllelvgesgnntstdgslpstpppaeeeedelyrqsleiisrylreqatg
tsanqenkarvr meeeaek          fv  ynpvekqmnmspppgnag vimsi ekmeadars yvgnvdyg  a
  tle                          k  q                                             
  gk                                                                            
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
akdtkpmgrsgatsrktlltlrrvghpkgfayiefsdkdgvqrnlalhetafqgwvrkvdiknedivkstsrvmisvtsr
eelmrhlhgfswvnlvaiesdkls              esitts   d slyr rqigl      dp rln pg htpdd
   ea ffdc sl      c af               ac rlg        l mlc                   lfc 
                                                      hk                        
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------gfveffhv-------rnvlmafa
gvtrwryrvtttsynssvsrhystinsrscirvyrrsiwsvlvrtkrswyvwyrhwp-------hedleggik---l---
 prnagriarlinfgafrakflkgf qqprgeplcgrctd      td lspqngtdmltkkye-pfplefw-sgw-twl
 fp                       hee aagfaecara         f kh    e chsvrtga  aar krkvqlf
                                                            al gd        lqegna 
                                                               a                
                                                                                
                                                                                
                                                                                

       490       500       510        
....:....|....:....|....:....|....:...
                                      
-v-gvgaglayl--------------------------
g-a---------irtpycetglifltvmetiantyfyf
esttkitimltrkdrvtvgaffask             
s rlltskivs wtqll                     
l c isnefil lkl                       
     lcaa a ga                        
                                      
                                      
                                      
© 1998-2019