Dataset for protein BCL-2-like of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                    :                           
---------------t--mfgy-r-------iy------------------rLl--------------------------
matpasapdtralmm-dceyrlk-naviglnlhcggaglgagsggatppggkmaatekeasarreigggeagaviggsag
             vadqwrtpttqalpvrky-eyc   p e p a d lhqa r agd fet frrtfsdla qlhvtp 
              vhpvsekdrnrgilmfvt v                   s                          
                fgga  dmke aderg                                                
                aa       d                                                      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
asppstltpdsrrvarpppigaevaffvfgaalcaesvnkemepdvtatparllffaptrraapleemeapaadaimspe
saqqrftqvsdelfqgg nw rl                     l gqvqewmvayle  l dwihssggwele  karv
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------------qtglqyvlqmprpG
eeldgyepeplgkrpavlpllelvgesgnntstdgslpstpppaeeeedelyrqsleiisrylreqadyakdtkpigqsp
r meeeaek           k  qn vekqmnmspppgnag vimsi ekmeadars yvgnvdyg rayew---ghgv 
                                                                   k evlearfadt 
                                                                      gcc he  c 
                                                                          da    
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               .  .               .          :                             .    
sgprqtse-----vlrrvg-------------dsvqrn---hetnfqgmldnvnv----tartlfnqvmekvfsdGv-in
atsskalrpvvhqtmqnaahpkgfayiefsdkfgfrkelalvrkalkscvrkl--vsvddvksr-sr--islterspg-r
evtpsppl   alcdkss              erlstr   y st seyssqphitpe -----va-pvdheprg i tt
 pnlvdvp    aa                ae eqs   f rl rdwqiy dlkng srqrt -tms-etlq  f p 
 a aa i                        d   i   d  f aaragg g   f npfq  tl g -  d    r 
                                          d   l c        i  g     a    c      
                                                  a           e                 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              *                 
Wgrivtlfafggilikk---------------l--qqiapdvdtykeisyfvteflvrntreWirqnggwd-------gf
a----aiis-eafvc-hgplvttrwkkwgfqp-lr-ktinqesc--plaewmas-imn--gd lvkq----nwhnhtp--
 ryva-f--y----ave               svnyem--lrr-ievyvrsiwdy---tlts yq--r  ek      ml
   r r-vv nsvr-r-               r kr--sdvqprgrrvrlrlvav ntrkht f-sy   g       e 
   l  ttt a tmser                  lsgg sagdcqqfqglcs r egqhaa  sps   a       a 
        n   s laf                  k ef h e aan cacar     h     hd              
        e   a                      e  e       g                  a              

       410       420       430       440       450       460   
....:....|....:....|....:....|....:....|....:....|....:....|...
                                                               
veff-h-------r--wmaf--v----tg-i-l------------------------------
----h-edleggiksvll--ag-rgvt--lay-layltvgaycgtklifltvmetiantyfyf
tklygvpsprplw-nr--tllesctlsask-lvgltvlrtpflesg                 
chkvetgfmlefrdkgkvswktlalilnkvvaiwtsrklq  fah                  
 as rp a  aaf lsegqafs    glaigsgmrriik                        
    ad        fq  n  l       f cei l  d                        
                             a     c                           
© 1998-2019