Dataset for protein Bcl-xL of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        *: :.  . :*             
-------------------------------------------------------sWkrtgsrpvnG-------------
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnpm hladlpaqk atghsssldarev

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                :: *:* ....::::    *********************************************
----------------lnrRyRrpvssmttq----PGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
ipmaavkqalreagdefel w pafpdlashlhit                                             

       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
*************************************************************************
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                                                                         
© 1998-2019