Dataset for protein Bfl1 of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSQTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************************************ :       :*:.. **. .
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWen------gfVkkfeHKsgw
                                                            gkwhnhtpml esva  krk
                                                                                

       170       180       190       200  
....:....|....:....|....:....|....:....|..
*::                                       
Mtflevtgki---l------yc--------------------
 al-------sim-trlktp--etglifltvmetiantyfyf
          cel slkdq                       
© 1998-2019