Dataset for protein BCL-2-like of organism Ovis aries

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                   . . :        
-------------------------p------tpasspstr----------------------elvvdflgyklrqkgy-
mgwpnlkylllglspyihasllcrt-taarmm---maqdvhcraqppeafaafpiygmqikrqaqwakyvsfv--p---s
                     gslp rrgpgavdtlteyna                      r lm wfk crsiavrp
                      g k gp gapa pfrdr                        q af m e  fqa    
                                   ef p                        k  e       f     
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------pvvgagtgsspaldv---------
wsqfsdveenrtetsegtesdmetpsaisgnpswhlaleiisqylleqatgtkdds-gcngapthgrsartrkvipmavv
lplmvgmas nspgpd slpstpp  eenedelyrqs                 rq lt---apetktsepgem    al
      e      al             e                         qk aspsp-kpr e aa         
                                                      ae  g                     
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :. ..          .     .              .:      .   .*** .::. * . :              
-qalreagdevetryrrtfsdltsqlhvtpgsayqs-ftqvsdelfqdgv-nWGRivaffsFggalckesvnkemevlvs
k--mqavassfqlefetavqqmlrkydivsvdtvrrmlerlmn---egppvs   latlvv easvtak---ttsqpkrg
h    r snrcl-nvqqnllpcaarfrrkretlqktias  vvkv s  it    v siit a i lvrqpvlnrrsiie
     h  ag  r hn   kg yd    hn kdaa   q  lehe r  gp    n    a   f amhlksilqkrcad
     d      d a                e      n  i                         e  iq    q   
                                                                       d        
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           :    .         *:  . .*                                              
q----------vaewmatylethladWiqsnggWd---------------------------------------------
dmsvsrdcrlliqtsvvafinrrtep lhesrd eleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsi
rgdmck     ltylitqvcvdsrr-  vqq   a                                             
p           slfc e  tknkge  rk                                                  
                 d          ma                                                  
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------gfvely-nnav-esrrlqewlnrwrltg
eekmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgf----ffg-g-at--ekgsv-fgnsywvr
                                                    tytl--sk-t-rtw-tvrgs-fllsvil
                                                    i iassehssqpsfqaqldretgifs k
                                                    e c   ddellkkal ke l  fgeq d
                                                    a        f e     d h    an a
                                                               a                

       410       420       430       440       450       460   
....:....|....:....|....:....|....:....|....:....|....:....|...
                                                               
mivagvvrl------glyf-ik-----------------------------------------
vtp---al-slstgs-slyw-rysarttnynssrsrfysgfnsrprgrvyrgraratswyspy
tvlttt--vgiaetdrrfpsr-lr                                       
laikrmngp     akqa res                                         
k fe lca        i  nc                                          
i c  a          g  la                                          
                   a                                           
© 1998-2019