Dataset for protein Bcl-w of organism Ovis aries

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYL
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**************                                                   *:  ::*        
ETRLADWIHSSGGW---------------------------------------------------AeftslY--------
              eleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekme darai vgnvdyga

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          * *::: .  * :              .:. **** *:                                
----------GdGsvnrvtrLre--------------snweSVRTvLt--------------------------------
taeeleahfh c aleeari cdkfsghpkgfayiefgdka    s aldeslfrgrqikvipkrtnrpgisttdrgfpr

       330       340       350       360   
....:....|....:....|....:....|....:....|...
    * : .  .. .**::                        
---rAvttsynssssRFysgs----------------------
aryg ralnlaegrg  faefnsrprgrvyrgraratswyspy
© 1998-2019