Dataset for protein BCL-2-like of organism Oryzias latipes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     ...     :                      *:                                          
-mmslnkelvvfyltyks-------------ssrryPl---------npt--g---eeq--e--arr-----d-g-----
m-fprrrqtlnvavksnmgftghilgsragemqcnv vsstvlshvp---ps-qvt---st-ys---tvsvt-p-tppnt
 scgwq sm-ashid ll             lcads  plllanesakrddddglkrpdhsdtrnnglhnsetgrsl ls
  tkck  - -w  a  c                    nhi         aa eeg   dl ah   ffdgd d l    
  sh      r                                                                     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .   .  .:    .:   ::  .:     .:    *       ..  .*:::                     
---ersppvstsmdaiksalrdtatefetrfstnfvnls-qlHitpdta-ssfkrVmne---------------------
plrrqqlsstgnnsgv-rtaqestnqyqrnyhrlasgi-vyr sgnkymyqtlrn vedvlekhkityngmivrlslddq
 elqcpc pcedaa mrel n med  lp  fqg qdfhsrk rd alc  naek ld                      
    aea c a      d  k d a   l  ala n   q                                        
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             *. *   ****:*.*:.* ..:. .  *.   .  :.              : : :  :*      *
-------------LfrDg-iNWGRvVsLfaFggalcvelvEk-nmgplvdr-------------iaewmtvyLdsqispW
gddmsfvssvaks vk ntt    i g lv vavvarscr rtgrshglspgrevapgpvscqavvqtvctf lnhqrn 
               g erl                qq k q e nec  l             ls eiaq  ggekqe 
               a                           d                          d   ed k  
                                                                                

       250       260       270       280       290       300       310 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
: .:..*: *  :            : :... :..   :      *  :                      
ivsnggWegFaeff----aarvrrsqetvkkwllvtvtva---lvGvllaqkr------------------
mqnqns dr vrl-gqsr--esvsqetsmrttmvagmslltgvgl stitlv-lmaifkglpastrlhnsr
lleh  c ckiy  ngt  esdpds l na flgig  l a lfflklnm                 
 h              ea   a  f   f      aaa                               
                                                                       
© 1998-2019