Dataset for protein BCL-2-like of organism Oryctolagus cuniculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   :  .                                         
------------------p---agmggvappdtrllvad-----------------------------------------
mfslrrnaviglnlylgg-glg-agadatsyanheiavekeaaarlevgggeagaviggspgasppaalapdarrvarpa
lslsqhipsfqkkqsslrltrrr-----sgqyeat ltk                                         
  aclgfgd hag  pap seqqmhtprmfgsv r  q                                          
                 l qaamkas cleer  a  m                                          
                      l     ea                                                  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               :                                                                
--------------yllyklstrgys------------------------p------pa-------------------sg
pigaelpdvsatparvsclarqpr--wleemeapaadaimspgeeldgye-eplakr--vlplldpvgeaskvpstdgal
              fih i pekqavpsqfsdveenrteapeetgpemst svissq  whaprslavrtatphpssl-t
                g c k    ecg             a dagaaea gafngn  pa ad   ang pg  paapa
                e          d                                                  d 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                             .     .       ..      :            
pstsp---------------------------------------asrvaq-tlrragdevqrrhrtafsgmlsqlhitpg
rgppkpaeeeedelyrqsleiiarylreqatgakdakpmgragsvtpkllevtfsvqtgfetnyerylqdltrk---kne
levq                                        tpnpvhqam qiaqqlslvlwpn hvysv- dvyvf
 ali                                        saaekan   e   d  eafqqf anvrga  ls  
  eg                                        m     l   c           d  e pa       
                                                      a                a        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        *    :  *   .***:*::. * . :               :          :   :   :      *:  
tavqsfsrVmeevfsdG--vnWGRiVtlfsFggvl--------ckesvskemeplve---rlaewmttylvrtlrdWiqk
ddrkrlaq vvhllrr vdts   v afia eafvldrgppvtavhlkninqvsdidtfkpivasiaevintqkht lvs
srytlatt cnke  h p       ivt a am        tqrvrrrqisvccs   svqylvvdr tghmgp  rq
n qgi n  ada     l         e   t          ak lqn aar  q   q plflcaf edrheg  he
h ie  e            i                            de      g   n         a   ae   d
                                                                           a   a

       330       340       350       360       370       
....:....|....:....|....:....|....:....|....:....|....:..
  **   *   :                   .  :     :                
qgGWd-gFvelygvnd----------lwsgwrtvllaaa-vagvvallaylir----
nr  ent tvffhtearpesrrlreg-e-sikrlfvvfvglgalgtggslfa-krvy
  a e ckk rpsvleladk    t-vrvnnw tttmtisvilsvalkyswt   
      a  a  enrsaa   f    sqtfl if srglq ccfilt kf gs    
             hpl          ple f    el ka   c       ch    
             d            g a       g f                  
© 1998-2019