Dataset for protein Mcl-1 of organism Oreochromis niloticus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtnflmskrnqctfidyllpqngvlegpmhygsgksspqnatgsskdssngivsngtpkrpnnlgvtstngyttkairdr

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     *******:*********************** ***************************
---------------------LERETKLlIHSFLGDFTGLSQPQRKETKALKtMKRVVADVLEKHRYAYNGMINKLSLDE
eedgslpstpeyhldgesdee       i                       m                           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* *****   ******.********************************.*****:************:********* *
RhEDMSF---VAKSLFgDHTTNWGRIVSFVAFGAVVSQHLKEKGRDNCVvLVSQEvSAYLLSEQRDWIvKNNAWDGFVeF
 e     vga      a                                a     i            i         a 

       250       260       270        
....:....|....:....|....:....|....:...
.******* ************ **********      
vRVADPEStVRNTLMAFAGFAgIGATLALLIR------
f       i            c          fwdall
© 1998-2019