Dataset for protein BCL-2-like of organism Oreochromis niloticus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------s------l---------r--pl-v---ne----a-r--
mtnflmskrnqctfidyllpqngvlegpmhygssrssvtyst-ssrktv-yyvsyktsq-ry--n-tvt--yttr-i-kr
                                mgkggpqnkmgqnkessngiirnglpk psnsghislrgqsnktgggm
                                       hal aegdlq f         nn  a cmc  pldi d da

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     *  *  :      :*    .  . .  .                 :.    :.  .:  
---g-----------------LerEtkllih---sFlgtstglsqpqrketk----------alkamrrvvadvlekhry
kfd-slpstpeyhldgesdee wk qriitedylt ncdfphtppaspsrsqqppsttdlda--etlkdtgweierryqr
eec                   de  l da ang  c     qa  q qa          vkam   lan f lq aa
  a                                                                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :..: . : :            * ..:. *   ****:*.:.** ..:.    *:  .                  : :
ayngminklsldertedmss---VmkslfgDhttNWGRiVslvAFggvvsqhlkEkgrdncvg-------------rvsq
rfsnlhstflvtpgpdy-qfvrn adevvr g-v    v gff  taalcvkiv qkpsplpvqqqelgqepmscrllve
  dd aqq hiqcahahcl lgk      a  hl               arecl  emgld a              ia 
              e     fea                                                         

       250       260       270       280       290       300       310
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :: ** .  . *: .:..*: *  :            :. ..: *:.   .     :  *:        
eisaYLlseqrdWivknngWegFveff------rvadpessvrntLmafagvatigatlaLlirf---rl
wvtv  gnhkqp lqsqga dr cki-gqsrsaesvssqetmkkw lvgmtfvlgvvagl vkq-wda--
tmad  de ik   ld     aa v  daa  errqd i a f a   gga l  iagk   lf
              i                                      c                
© 1998-2019