Dataset for protein BCL-2-like of organism Nomascus leucogenys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------mtdatfpytrrlvqdylqykl--------g-----------------------rip
mfglrrnaviglnlycggaglgamsggcepgdiyliaaefvgsv-reigggqk-yvwgagpgasppsvltpdsgrvaq--
                      mga-p-sa-ggeealtkkea-ars     ea asisgsavveenrtea eprtfs-pe
                       a-v-sn-y-- a  vgln- -        r  ecdqfsdgaa pga  a  ie sqa
                        hsqrmrerr n  m  is c                d             cc gm 
                         a qlg ln    i   l                                   eg 
                                         h                                    e 
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qpga----------------gpsktsrvlq--efpvadev----------------------------------------
g---evsdvtatparllpfp--t---a---nvaasaqka-mspeeeldgyepeplgkrpavlpllelvgesgnntstdgs
-itsipgnsswpv dttfvnts-rra-pmeem-g-----l                                        
plsphnaaprdhl  ssal aaggplsaadrsl-ippppi                                        
th              p e   atmg s lpr va mav                                         
                       ahe k gaa s                                              
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------hqtlrpagdnvnv-----f------l-vtp
lpstpppaeeeedelyrqsleiisrylreqatgakdtkpmgrsgatsrkaeknmkrcl-eferryrra-sdlasq-hisi
                                                  --a--qv-pg-qtnhettlqgmvarvelkn
                                                  le-  a-h - --af  d gywtrk d---
                                                  klr  -l  s ss      aepsng   vv
                                                       e   d fl         lc      
                                                                        g       
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 *   *                                                 .        
gtartsfsqvmeelfsdG-inWGRiVtffaFggilc------------------kklvrqemeplvd---eiaewmaeyl
dsdvqrlnr---ke-eg p-t --l-alis-eaavvergplvtarwkkwgfqprveslnkrtasdigtykrlsyfvtsfi
ed-qkl-t- vv-vprr ivr   - -i-v --f-a                  ah-ktinqqvcce   qvqasivdv-
-- --- -t sdh- qp vt    v  -v- a -m-                  --e----vsr as   pfvrllwa- 
lm ysv ed  n   c   r         e   v l                  l  qerdh k  q   n clccstr 
f  dg  a           p             t                        dg      a   g         
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      *:                                                                        
vrnlrdWirqngGWd------------------------flev-----g-rnv---------------------------
mnttge lqsqr--entrrtpghgagfvkkfepksgwvt-vhlydleg-ki-lrelqnevekqmnmspppgnwgsvimsi
ntrkat fvks-  -g          raagkr rgrfmelf--tgmleei-vek                  aap     
e-h-hs  h--   vt                    ehwk-ymeea  qass-                           
-g-hep  -e    gs                    hgnhmsgr     pprs                           
 dq  a   d    al                     fiaar l     nnmr                           
         a     k                     a   p d     dlli                           
               a                                  eka                           
                                                   c                            
                                                   a                            

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------llafkg--gvgagla-l-------------------------------------------------------
eekmeadar-s--kvayc-----y-irslhlalvynyvtintfnpvtppqlfayiefsdkesvrtslaldeslfrgrqik
        avfra-tv--sfsvllvttmftifntvirmsllnylgslhakg                             
        -t-lvdqpryntwwttgnnlesgcgstfiikfkcdkflk                                 
        ssvyt rkmplrtims klh     dgacf  ga ddhg                                 
        pgthl nedlenlfif ea                                                     
        mei e a aid kaee                                                        
                 f                                                              
                 a                                                              
                                                                                

       490       500       510       520       530       540   
....:....|....:....|....:....|....:....|....:....|....:....|...
                                                               
---------------------------------------------------------------
vipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgrarvtswyssy
                                                       agaffapk
                                                               
                                                               
                                                               
                                                               
                                                               
                                                               
                                                               
© 1998-2019