Dataset for protein BCL-2-like of organism Neolamprologus brichardi

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            :                           .*  .          :     .  .*  *.          
--------vtrymryk--q-------i--n----------sGlwseqrvttssylsfngtspnttPpsPsrsq-------
mmsqqselmlnkims-rs-rtyplyl-vq-gvsnrtmhygc nskptnilghdngtsccivshqp kr qnrevtststy
 crenrdiagf  kf ln cnfidnh pl eplegpdggaa  de  ladaeakd       gga ap delaqqppngt

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                            ::.    :.  .:   :..:
---a--e-----------------------------------------------------amrrvvwdverrhryafsnl
ttk-vrdreedgslpstpefhsdsesdeqleretkllihsflgdftglsqpqrketkalktlkdtgneillqyqrryngm
dld ika                                                         laa f ek aa  dd 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 . : :         .  * ..:. *   ****:*.:.** ..:.    *:  .   .              : : :: *
istlsvtprtey-ssvrnVmkelfgDg-vNWGRvVslfAFggvlsvklvEkkrsplvg-------------rvvewitvY
hqqfllqegpdhmqflgk adsvvr htt    i gfv  taavcrhil qgpgndpaqqqelgqepmscrllsqtmsd 
ank hidcadadcl fea         hl               aqeck  emdlc                ia e aa 

       250       260       270       280       290       300   
....:....|....:....|....:....|....:....|....:....|....:....|...
* .  . *: .:..*: * ::            :. ..: *:.    .  .     *:     
LlseqrdWivsnngWegFveff-----arvvssqssvkkwLmagag-vgtgvvtglLir----
 gnhkqp lqkqga dh cki-gqsrs-esrrqeeimrht lvfmtfavlagtlfa vaqkrl
 de ik   ld     a     daa  eadpd   a f a     i alaa        
© 1998-2019