Dataset for protein BCL-2-like of organism Myotis lucifugus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------------------p------
mfgpkrnafiglnlhcggavgglwrqrslhllqeggpcpqesgagretgtvigwsmlssvsltlythpsvvar-spmgtr
                                                     pneghlpqfmkasfdgrlsptkvlsrm
                                                     meafa dna   rda ldil ftiapk
                                                                            a ge
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .             ..                                                       
--d-tapptralvldf--yklrqrgy-----------------------------------------vcsggpgegpslp
gp-rssqdsqw--a--vgrstsvkncpwswkalaadaimsppeelgsyepepsgkrpavlpllqlvgeaga---a-gaad
strpqrlsn rglve lshrpis  tsrrqgsdveenrteag gterevet laiqgnpswhvvdsp----at -s--  
asqgmkdra g ct   efp ar    eelf a        e   dg        n           avne   h s   
  pel a   e                                                                     
   ah                                                                           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :                                                  :: .            
--p---e-pvhqal-------------------------------------rragdefetrfrrafsglva---------
st-ppp-eelmrsmrqslemisryrrqrtgardqsqlggprvssvqaletl-a--------yettwldtt-pralclvrd
qrevtamatekllf     i pqhleeaa  k akp    aaggrk      -vaggvqvnqamq mrs         
aq si   a ee                                        e   csgrhh h    eph         
          d                                                l a c     lg         
                                                                     a          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          :   :     . .                                  .                      
qlhvtpgsaqqsftqvsdelfrdg--pnwgrlvaffvfggal----------cvesvnkem-plvgrvqewmvaylettl
swstvqrnryersveqvvsrvqg-tdv----i----s--a-slerpppghsqhrrewdq--e-cisqlatltttwrvmrh
r drrnetnvkqmsdgmsha pn   -tnly- tlv-wc-cq          allamshtvqvdfrppvsflcsv tkhg
e apeg d l pgl alna           sv  h f al             ik i a  ds cq id diadl sgae
   i     d c e  ie                                   a        q  e     g    ne  
                                                                             d  

       330       340       350       360       370       380  
....:....|....:....|....:....|....:....|....:....|....:....|..
  *      .     *   :             *              :             
rdWihsqggw---dgFvelygvedle-------Gnwrsvrlvltg-agvga----glfflir
av mvkntchgfkae taff---a--esrrlre gvannltafa-avalvllvtvcawyasm
kt ltesr      t chn qpn-pp a k    qrllapwlr- vmt rgvlll spisrk
ep eqai             mngpaa        di f   f    lc a ii i  l k  
 g  e               hda            e                     a    
                                                              
© 1998-2019