Dataset for protein BCL-2-like of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfglrrnaviglnlycggaslgagggspagarlvaeeakarregggeaallpgarvvarpppvgaedpdvtasaerrlms
                                                            matp st  tr      mhm
                                                                              ak
                                                                               a
                                                                               d
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mae-e-m-irelvedylqyklsqpgy------------------------------------------------------
qs-y-f-ynhsmavhfvsav-qvkafswsqfsdveenrteapeeteaeretpsaingnpswhladspavngaddlyrqsl
s-grllydt--i-asaig--vr----ldgcepeaigkapavdplplrvspaaksssfqgespstpp pehre        
-tplttvh-ea-lmk-ahfi -preeec ag     dggdclaaldgaa p gifgad  ln   m   eed        
apdasgppp r  -- -a     e  v         e    ar   tpe   t v                         
 q s aer     s   -                                                              
   p h           f                                                              
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------ap--acrvlrrvgdsvqkrvrrnfssyldqlhvtp-gtarqiFnqVmeelFedGv
eiitghsssldarevipmaapgles--sqvkqamqeaafefeleyekalkdltsdf-iesidstyis-et-vnke-rg-i
   sryrteqptgslvstpggeegpvgrv-hlt--a---g-srnhgtt-qgmaa--d-kn fgdqkrvtrmsdhvlq-d-
   maalr  al pkdck l aasa aprlle-  - trdi-t-f--d ae-srk  l-- e--vg- s- -v-- kn p
                ag         dpef-l  s   -  - -qe- --f--    sr -nr--l a  a-   -k q
                            k -a       q  q    f    ce          le  -       s   
                              a                                     k           
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
n-nWGRiVtffaFGgvl--------ckesvqkemeplv---kqvaswmaeylnnhl-----gewiqrngGWedf-ik---
if----l-aiis--aavmnqgpymalvklpdeqiavdigaysrisdfvvtfiidntmgrrhed-lres---d--f--kfe
t s sq- -l-v a-fm        aahtsnrnqqlgcc  g--q--ita--etr-     apr-hs-r  -rgvelygv
-       m-le   --        ----ktvadssf    -pl-lt---v -r-k     r-  --q   vgstdffhn
p          -   t         v qk-s--nc i    endcel  d  v-t      -t  vkl   atesa lrd
d                            r-lg r      d   c   n  m l      ha  ed    ge cr als
                                         t          y             q     v aq  kp
                                                                  a     l       
                                                                        a       
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
p----------------------------------------------------------------flq-tgqfwerlfll
-ksgeeaeklkelqnevekqmnmspppgnagpvimsleekmeadarsiyvgnvdygataeelwlt---mg--r-vmtlmv
qale                                                          earrgre-fw-s-liaft
ndaa                                                          lshkygtslninftrv-e
gsrp                                                           fdcswvrnigvg--pva
smp                                                              shklpsvarwsphnq
rlm                                                                 c  rtllg ghi
ae                                                                     lski  -cg
                                                                       knf     d
                                                                       h        

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
k-------------------------------------------------------------------------------
gvaglgagvavgslfehktirtsvqlppsllrgrqikvipkrtnrpgisttdrgfprsryrarttnynssrsrfysgfns
vapcvsklltysafcsspsvgselagdeq f                                                 
-wvpipghfclllywarerl                                                            
cfsahaefaltpi siw  e                                                            
q gfa    veie lgv                                                               
          da   dk                                                               
                                                                                
                                                                                
                                                                                

       490       500
....:....|....:....|
                    
--------------------
rprgriyrgraratswyspy
                    
                    
                    
                    
                    
                    
                    
                    
© 1998-2019