Dataset for protein Bcl-w of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
matpastpdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrtfsdlaaqlhvtpgsaqqrft
--------------------------------------------------------------------------------
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  ******************************   :       :    
qvsdelfqggpnwgrlvaffvfgaalcaesvnkeMEPLVGQVQDWMVAYLETRLADWIHSSGGWaeftalygdgaleear
----------------------------------                              vrssqklrvrsm----
                                                                eleai alsae   ea

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   ..  .:  *    *                               
r----------------------------lregnwasvrtvltGavalGalvt---------------------------
-klkelqnevekqmnmspppgnagpvimsykvkmhgkigslyv wgdy kt--eleahfhgcgsvnrvtilcdkfsghpk
e                             e  le dpimg n ca  gae                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfprsryrarttnynssrsrfysgfnsrprgriy
                                                                                

       330   
....:....|...
             
-----vgaffask
rgrar--------
     atswyspy
© 1998-2019