Dataset for protein Bcl-xL of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************                             :  . :   .    * .      
VLVSRIASWMATYLNDHLEPWIQENGGWvt---------------g-------fttpmvvpgv---vcvssLferp----
                            drfvdlygnnaaaesrk-qerfnrw-lrgltcaplaehallgl cshktegs
                            gv              s gtplrsv r lv        dp  w ve    

         
....:....
         
---------
evqgppqll
         
© 1998-2019