Dataset for protein BCL-2-like of organism Monodelphis domestica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              :    :                                                            
------asshdtrelvtdylyyklsqkgy---------------------------------------------------
mmmytp-rryynnavirlfvshvqrtrpvnwsqsgdpsrtrvlaspslptvvstspswgigsvqtrttplplipqdsras
  dmpmymppsvhriamknikcggqrp lgggafepenglelpeggki stensp qvdgfetepgnagagahgggiatv
  ahkgrlgfkkam  i   h ccagm ae      agdg a   aeg p  aga ar              e a     
   addlgfee     g   g     e                                                     
     c ea       a   e                                                           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------a-------gp-p-------------------------------------------------
ttatvsssslpvprpapva-eatgpte--v-tlfapgrcssapaevadgaadvpmcpeeeldgyepeppgkrpsrlavle
spnpgrpgprglhptivig cgpdvqvsstts                                                
pg aahn a daae   a  a a  gtl mlp                                                
                           d c n                                                
                             a e                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              :. ..  .       :. 
---------------------------------------------------------pvhqtlrrvgdefqrryrrdfsd
iareggdspngslpstpppaeedeeedelygqslelisrylreqavgtkeakplrsgkasramqqasssveqnvekamet
                                                         -tlli  l afglssihqdt qg
                                                         vlke   k   d rlef  f de
                                                           aa   e              c
                                                                a               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    *           .  *      .   ****:..:. *.. :    :.: .              :   :   :   
mlsqLhitp-gtarqrfvqVveelfrdgv-NWGRivaffvFggalc--vesvnkemepl------vgritewmttylvth
ltrt d-vsvespyrvvtt atlvdsgept    vatlvs aavv-khmkkllrhssv-tmrtetsdslassiaevinrt
csnk -vln vedqksiss snkm q  ii    l viie   imle l eidq rq- qlgr  qrqvslklvnf mnr
aag   lkd r  igi nr mkhe e  f          a   f a  i      ec        iep qhf cd  ekq
  a          e a en  d                          a       a          e  d      den
                                                                            d 

       330       340       350       360       370       380    
....:....|....:....|....:....|....:....|....:....|....:....|....
   *: .. **   *   :                        :             .     .
ladWiqengGWe-gFvelygn-a--e-----------w--lrtvltgaa-vgalvtlglllvvk
krt lhssk  dnt tknf--s-le-srqsrplfdss-ps-twlssamwag-g--g-aaffssr
ihp  rqq   t e hhh hvqtaagk kgqrrsngvnntvknimlliv -v-v -v syylr 
 ge  i   a a  af epnm   g   peprefn lnicd  akft lf g la iasgl 
 da               dgd   a           a f c     l  a c       fi 
                     d                                       ah 
© 1998-2019