Dataset for protein BCL-2-like of organism Mesocricetus auratus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .* *:.*:: :   :                       .  * *.:                         
matpasapdtRaLvaDfvgyklrqkgyv----------------cgagpgEgPaa-------------------------
-----rvr-n l lv yltfcase----wsqfsdveenrteape--pser t stingnpswhladspavngatghsssl
  d lmsqs  e  t   s        s                gae dp p p                          
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .    :* ..:::: ...  **.:..      *.  : : *: : :: .*   ****:* :: *..::  :
--------dplhqamRaagdefetrfrrtFSdlaaqlhvtpGsaqqrftQvvdelfqgGp--NWGRlVaffvFggalcae
darevipmsavkall svaeqiqqqyhff  sfvs----yq tryesme msnavlrd vdl    i llls aativvq
        a ea    e      l h  a    tg   i   n v l         p  q           a      s 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.  : ::  :  : .       : . *  .   *:  .***                                       
svnkemeplvgqvqd------wmvtyLetrladWihssGGWd-efvvlygspa-eearkl-e---------------gnw
eqrnrlqvkmsvlascqlivallcnr nrhhrs lqdq   eltatkirvrnml------r-rqnevekqmnmsppp---
  d   k kri          a   ld  ep  ean   a g ieaf nglea sergq lf            ldfa
                                             ca   de a      k                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               . .       .                                                      
--v------------rtfltgvvaygalvv--------------------------------------------------
st-lmsleekmeadakwvyvcntvtavvlteleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldesl
gslii           si s midl itfl                                                  
ap                   a  a   ae                                                  

       330       340       350       360       370       380       390
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                      
---------------------------------------------------------------gswfssk
frgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgrarv--lyrry
                                                              atafkapl
                                                                    l 
© 1998-2019