Dataset for protein BCL-2-like of organism Meleagris gallopavo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
msssnrelvidfvsyklsqkghcwseleeedenrtdtaaeaemdsvlngspswhppaghvvngamvtrssyyvyylvrdy
                                                                aehaefle heiaqas
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              * **  ****::::: **
--------------------fs---s-l-i--eealq-f------------------vveelFsDGv-NWGRivtffsFG
lvyvtqrsrlgpfqtryrrv--nmt-s-q-tt-----s-lqriditsvdvakrifng-mnhv r  nt    vmalit  
dqrqlledagdeael vahalrgllrq hdqpgtdyrpvee                 aa k h           i e  
                      dia k e kk     a cd                      a                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. :     .            :   :*  :      *:  :***:  *:  :                            
gvlcvesvsrems---vlvssiaywmTeylvshlrpWiqsnGGWe-gFvdly-------s-r-l--------k--lslvt
alvtkklqnqnvrltgpekgrlvtii taitrskhn lmeq   dnr ltkfrvedlnt-m-p-rkgswtsr-wp--gsl
 fma h kekgqq   kcieq ssf   nnn de  dd      a  ef     ggsaianvfdfqeifnrtl tfma
 a      di  e   e  dn  g      id  aa   a                 en a e       el si   a 

       250      
....:....|....:.
.         *     
vagvltlgasLsrk--
itdiilavsy gymyy
fgacfg  fl fhdir
    aa     a    
© 1998-2019