Dataset for protein BCL-2-like of organism Maylandia zebra

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                :  .. .                   :              :  *      .    .     . 
---ysqnrelvltyiryklsqrgyplnhivv-e------g-asgldspqridthangtsnGtspgtppaspqrlqqqsps
mmnmmylvtnqcflpnhlitsnnv--gsvhln-psnrtd-gva--seeptvvstsrmsft vvsssttkrktqryvtptn
 aingmfkrifekime dhpka fvw-prayq edaann sitsnhp hnlthskkearg pthngsahlcrn prsd h
  e el  n      c        le fm            g  f    dapgrcid    idgean eg d  e r   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                               .:.    :.   :   :
t----avk------------------------------------------------------ealrrtgneferryqraf
atdldvirdreqsgslpstpkfhsdsesdeqlwretlvlihsylsfdftspsqpqrpptkslrvmkdvawdvllqhayry
gyktkgcmc  eddiagrkme cg        ek  kl aedf g cciglh appkeseaakt  elvd l el rpd 
       h                                                      a    a a i  k  a  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :   : :            * ..:. *   ****::.:: * ..:.               .:   .      : : :
sdlhsqlhltpatayqsf-enVmdelfrDg-vNWGRivslfaFggvlcvecv-----------ekegmspl-vgrivewm
tnmsrtfsiqsspeqrrsvrk iksvvg htt    vigfme taavsrkl-eqkpgldprqqsel-resyscrnvaqti
ng iqk lvderddhml lge a       hl      a      t aqhil           qnk qdnq  dllsde 
de an     cg  dc   aa                              a           k      m  a      

       250       260       270       280       290       300         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
: **    . *: .:..*: * ::       .  :    :  :       .                  
tvYLdnhiqpWiqsnggWerFveifrq----dadsesrrsqesfkkwllvgmtvvtgvvagallaqk--
se  nseqrd lvdqna dg akfygvarevsraavvsktlpaiagvgglaallalvr-----i---rl
ad  lgplns  lk   a c lsds    qqe smkhawm a tff i l glasltiwdy-t    
 a  ge kk                 r      if c  f     a a   f  lisc  a l    
© 1998-2019