Dataset for protein Mcl-1 of organism Mandrillus leucophaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************                                            
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLatekeasarreigggeagtviggsagasppaaltpdarrvarpp
                                    --------------------------------------------

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pigaevpdvtatparlfffaptrraapleemeapaadaimspeeeldgyepeplgkrpavlpllelvgesgnspstdgsl
--------------------------------------------------------------------------------

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             ***************************************** :  :     
pstpppaeeeedelyrqsleiisrylreqATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGmlrkldikne
-----------------------------                                         wvcgv-----

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            : . *  .*                     ::.*   :. .  .      *.*:              
ddvkslsrvmvhvfsdGvtnWgrivtlisfgafvakhlktinqesCieplaesitdvlvrtkRdWlvkqrgwdgfveffh
------------lpcr prr ---------------------hqk aagfcrccws------ s f--------------

       330       340       350
....:....|....:....|....:....|
                   *:.  :* *  
vedleggirnvllafagvaGvgaglAyLir
------------------- isnki l --
© 1998-2019