Dataset for protein BCL-2-like of organism Mandrillus leucophaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------r-lv-dflgyklkq-------------------ggaglgags---------------------------
mmmtpcsfpdt-e--v---sf--srngviglnlycwsqfsdveepqp-s-pstggatptpgrlsstpswhtvpspatsrv
 aasdaeagynyrkaqkyvq-v rika       v         ---v-se-ppsvmepgsiingqggkdlphpgrsgda
  haqstsysigairaavimlg q-r        s         sryeyp-akeaed a  aflan a   kdma vrpt
    grngqmf l  n   - n -l         e         natdv w -   a                   fngp
      m        m   h   yc                   k k p   q                       e a 
                                            d g c                               
                                            c   a                               
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  .    .             :                          
------------------------------alratgdefqtryernfsplltqlhvtpgtaaqs-ftqvveelfrdg-pn
lqktsslptrevppmaagpalspvppvvhq----aeksvekevritgkemgsvvnisaidtyrrlastpmarevqrpivp
vrrs p dapaaiaa            pggtmlrvafrasrprnkglgdcadniggasvssqpthsnsldnkr-eg-vi-
tgp                        lterwkq  sgp anfatawrgawasmdtpnfagpta llr sdhv a-  - 
sen                        rllmpeg  ldm lgs  r q svrl ask endvkg  e   v   -   t 
edh                        ak    e        l  d n ptpk  lh    rg   a       s     
aa                                        h    a  sh                            
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    :.        :  .                                                              
wGriVa--------ffsFggalca-----esvnkemeplvd-ia--------------ewmaeylnnhladwiqsn----
i-alitdvtatparliaveatrrvagdefkllrrr---d--t--eispgtayqsfeqd-fv---metragearrqseeel
- -e p        iav apivik     apreq-iqv-lsryqh t           y--vtfimrptepslmeq    
   v          m f kqvmae     h kdenqascigqvk              asitavgvdnkrt  hkp    
                e   f           yi as   tsql              t  el   at h   vg     
                                t   f   epl               l   d    a     kd     
                                         n                                      
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :                                                                             
gGwe----------------tfvelyge----------------------------------------------------
drydpeplgkrpavleeeaepl------sgnspstdgslpstpppaeeepvimsiedelyrqsleiisrylrnqatgsrk
fnl aika vrem     k-lvkvnn      vekqmnms   gnag       ekmeadars yvgnvdea aelkd
 g                rgtafqhv                                            ym paael
   a                n k  kfp                                            sg gde e
                    g f  f d                                               e    
                    e                                                           
                    a                                                           
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                  .                             
-------gwtsrktvlt---------------------------gvvllgsllsrk------------------------
trprfrs-alnvrale-lrrvghpkgfayiefsdkdgvqrnlalhetafqa-fkkvdiknedivkstsrvmvsvtsrgvt
gqemgngw--t-mwt-agmtsa             es rts   -lsevvgyv--g      dp rln pgihtpdd pr
ekrlrerssv-tlpmvsdkl                        kiitsr w-tvy                 lfc  fp
aahfhkfnirllvmitg af                        dccgml rrrql                        
     gc fm hglffc                           aaa    mqih                         
     d   h g eaa                                   h gg                         
         f f                                         c                          
         a                                                                      

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rwryrvtttsynssvsrhystinsrscirvyrrsiwsvlvrtkrswyvpyrgwdgfveffhvedleggirnvllafagva
nagriarlinfgafrakflkgf qqprgeplcgrctd      td lskq                              
                       hek aagfaecara         f                                 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490 
....:....|.
           
-----------
gvsnklaylir
 igagmflask
     i f   
     c     
     a     
           
           
           
© 1998-2019