Dataset for protein BCL-2-like of organism Macaca nemestrina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :    :                                                        .    
--mtdmsgpdtralvadylgyklr--g---ga-----------------------------apg---------pgpaasp
mm---cfflyryrvaq-fvqcvgqqk-yvc--gtvgattpggrllatekeasarreigrlpitqvpstspgttepagprk
 aaapaeagkinei--l-iylnaygr agwdgasppgap                   gglggttkgsrashsshsvlds
  h grtryrne  lmkn h g scl  es   dg                       aaee  iiepq mgr a tstr
     pl e     ig     c a g   l                                  afdgk  ap       
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
t-------------------------------------------------------------------------------
larrvarpppigaevpdvtasparllffapvrrtsplptpeapaadaimspeeeldgyepeplgkrpavspvppvvgesg
d                             ta ag  eema    a                   g  ll llel     
a                                                                               
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        ..   .  . :  .   .      
---------hrtlrqagdevqrrfrrtfspmlrqlhvtp-gtartrftqvmeelfsdg--pnwgrivtffvfggilcke-
nspstdgslsqvmqkvafsfeteyeknlkglsdnvn-asidsrvql-n--sdkvlrgsigitsrkllalvareaa-iakl
         psappa----lsksvftayrdcaa---l-n tndqk-vatmvvpegqv v    v silt v -v--re
         llr  r eegehenh ss qiy--y riqa fg kgsl-r tkhm e  p t    a etis a vmlvh 
         ae   p   d d l  qd eei sk dek  ed  e  sl a a       a         r   t aed 
          a                 a               d                         e   f     
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        :           *                           
---------------------svnremeplvdtyqe---wvveyl---rlrdWiqsnggwdg------------------
ptvtawwkkrgfqprlkeqegllrqriatdfgqvk-isyfmag--mctntge lrqsr--e-eaikarvremeeeaeklk
kli                  nqqknhsraaqsi-s   vltafie rtpat hhkqa  -n                  
                     g esdcq   en-tl   r crv p nqkhr  vdc   gl                  
                     d a c     allsd         n  hh a   a    ak                  
                                g a             g            e                  
                                                             a                  
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------le---------wgsvrtvlilave-agl-kgfay
elqnevekqmnmspppgnagpvimsieekmeadarsifvhffvygag-emrrlwsss-agisnlt--l--v-ahvt----
                                     ytgnyrvpy-pvklperkrgcmtwnrm-tqilvsv--t-vyyl
                                      celvhslftlsekfcpfhn lnlmpkiskfflmssvplqlmf
                                       a  geedpgfc eaheg  hfhlk  lgcdklllilakkga
                                          dd  af a c fdf  f fke  ga cgggc k agc 
                                               a                 a  aafc  g  a  
                                                                      a   a     

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
l-------------------------------------------------------------------------------
-hksdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgra
ief                                                                             
g                                                                               
f                                                                               
                                                                                
                                                                                
                                                                                

         
....:....
         
---------
ratswyspy
    itrll
    ask  
     r   
         
         
         
© 1998-2019