Dataset for protein BCL-2-like of organism Macaca nemestrina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
m-----------------mfglkrraviglnlycg---------gag-gag--ga-p------at---------------
-atpgsapdtralvadfveyryrynllvdyyqgvllsqrgyewd---l---sg--t-pggrll--ekeasarreigggea
 tdca             rtkpitkraqadl-hyk         arqv yvtpa d lpqimsspgd fet frrtfsdl
 mhd              psaedqeg-----v  c         lgdp eap   a ah afrgq               
  aa              gl   n eilmkfi               k   c           ea               
                  a                                                             
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gtviggsagaspprftqvsdelfqggpnwgrlvaffvfgaaltpdarrvarpppigqvqewmvayleaevpdvtasparl
aaqlhvtp saqq                             caesvnkeme lv            trla wih sggw
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
lffaptrragpleemeapaadaimspeeeldgyepeplgkrpavlpllelvgesgnspstggslpstpppaeeeedelyr
ele ika vrem     eklkelqnev kqpnmt p gnsgdvimstspkptpdaraiyvdpv spygav   l ahfhg
                              m hs h aaa  p arie  meaa p aaa na  dv  t          
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------g-----pmgrsgatsrkaletlrrvgdgvqrnhetafqgmlrkv---p-dtvkr-fnrvme
cgsvqsleiisrylreqat-akdtk----e-sgps-tsrv-qq----f-krvrsnlrpc-dqlnvt-i-dartllsq--v
    nrvt lcdkfsghpk tpyprqspqps----svhq-m-kaafs-s-effrtykeyv-n-hiksgta--s -a-pv-
                    faeiefitp-avvtdplalr  -   elht-- kl sdwss- dlanes-rq- v-tmsi
                           dk  prl l  da  a   d e sy  d a rqig     fnrqgl ttl gd
                                aa    a                   lac        ipe      a 
                                                            a                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     .                                                                      *   
kvfsdg--pnwgrivtlfsfggilikkl---------------------nvapdveplve-isy-lve------rdWivq
hltersvgtra----aiia-eafvc-h-ltqtawwkkrgfqprlkeqegsqnscmdtykgsvtsw-a-ylmnttgs lrk
eeprg p it ryva-f--y----aveykri                  riereisvfarrlwdvv-rfintnlte yq-
-tlq  i v    r s-vv nsvr-r-eslv                  -srkrgrr rdqcrlfmtg  errkht f-s
s  d  f r    l rttt a tmser pgf                  dhq  cqg canaqer  a    qhaa  sp
a  c              n   s laf                           aa    l aa        h     hd
                  e   a                                     c                  a

       410       420       430       440       450       
....:....|....:....|....:....|....:....|....:....|....:..
                                                         
qggwdgf-----------------------r--ll-fa-v-g-itglayl-------
n------veffhvedlelfrrsregnwggi-nv--a--l-g-vgaeg---irkymal
-r  gngtvlygssmrpeadfl     aswlktwttavgmaal----vshwkrll  
y   ek fhkkrppfpl          wlvktl mslmpltlkvvvsllfltqkc  
s   ae ca   dga            ffs sg iqhleac isnlmgf ks     
     a                      ep    hn fa   clcki a gh     
                                   g       a af   a      
© 1998-2019