Dataset for protein Bfl1 of organism Macaca nemestrina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************************************ :           * ..: :
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWgn-----------Wmthmpv
                                                            ekgfvkkfepksg hnflem

       170       
....:....|....:..
   : * ::  *:    
---lvEsvsllKqym--
tgkic mlahk kkcal
© 1998-2019