Dataset for protein BCL-2-like of organism Macaca mulatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------atpasapdtralvadfvgyklr-----q-gy----------------------
madmfglkrnaviglnlycggaglgam----t-------at--------iiggg-k--vcgagpgvsptrtlapeprrvt
   pprertsrylhdyvsslpriaargsggc-pgynyri-qkylqsvrse    er tswsqssvgeeppget dggifs
    ll ilepl aas g cal   mamadrefygi l e-ekis a q      a  eidgfddaaanaaa  aa   a
                           h   msqsg e  v  eh                  a                
                                g       p   a                                   
                                        m                                       
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------egpaadpl--------------------------------------
ssppitpsvpnvtpswartssrpvtgatspsssmga-gsg-smspeeeldgyepeplgkrpavlpllelvgesgnspstd
rqemhgahpidsrdpvklvlppatprrpghleelpqre--vm                                      
ep ge  eaaagnamph lgll qna aaaaaaa--k-vra-                                      
                   dff pk         dtaltp p                                      
                                   p dpk i                                      
                                       i                                        
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              .                 
----------------------------------------------------hqalraagdeferrfrrtfsdlaaqlhv
gslpstpppaeeeedelyrqsleiisrylreqatgakdtkpmgrsgatsrkasrtmqrv---vqtnyetalqgmlsn--i
                                          tpea vlpvvlev--q-afslskevfknykpc-rkvn-
                                                 ast---  k   g nlsh spvrsytd- dl
                                                  a klr  -   d h  w pd pe s-h   
                                                    aa   e             a   t    
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .  :    : ..   .***:*::. * . :                                        :
tp-gtaqqrftqVseelFqdG--pNWGRiVaffvFggalckesvnk------------------emeplvgqvae---wm
-siesdvtslsrmmdkvlsgsvgvt   l tlis eaiviaklltqtawwkkrgfqprlkeqegrqavdidrlqaisysv
kn ddrrklvnt vvhe r  i t    v siva a fmavhekri                  niqsccstikl   fi
a  fn yg  el ana  e  p i         t   v ler pdv                  dvsr  epyv    ll
       e                       e   t      lr                        qn        
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :      *:  . **                                                              
vayletrladWiqsngGW--------------------------------------------------------------
aevinrhtrp lhqsr  lsqiteaemadevicseilsdcdsapsspdledleaikarvremeeeaeklkelqnevekqm
ttf vntkge  vkq                                   e                             
sdr mdnhet  re                                    a                             
 s  agq ha   d                                                                  
             a                                                                  
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------Gn------------------vaffrtgeere------gtvrnglvllgslv
nmspppgnagpvimsieekmeadtfvily-fnalgwghrfevrglecgwaey-ekrrll-nrwhstrsivtvvlafdkvs
                       erteyv dvs                gdlsaaaqg-fgnfflvamwnrmtiqcagff
                       a saen -                  --eg-----wmahlagc ktlalasmpvayc
                          gal                    cp-ehvvspe tf eva g kshmp akvsa
                                                  kkafspfd         f hk     fqpt
                                                  hg  pkd          e ce      la 
                                                      hec                    e  
                                                      g                         

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
gvg---a-------------------------------------------------------------------------
sh-agf-ylefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrpr
trpkflgsk       i                                                               
--kta   i                                                                       
lssg                                                                            
ala                                                                             
                                                                                
                                                                                
                                                                                

       570       
....:....|....:..
                 
-----------------
grvyrgraratswyspy
            itrll
             r   
                 
                 
                 
                 
                 
© 1998-2019