Dataset for protein Bcl-w of organism Macaca mulatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       *********************************************************
-----------------------MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRF
mpllilspyihasvsslpliaar                                                         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
RRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADW
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******                                  *          *** .*.*               ** ..
IHSSGGW--------------------------------e-EftklyvrgmlEEArrLrE---------------GNwgs
       lsqiteaemadevicseilsdcdsapsspdleal aiaargdeae   ek k lqnevekqmnmsppp  aap

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*            *:: .* *  ** .                                                     
V------------RtvyvGnVdyGAtvt----------------------------------------------------
 imsieekmeada silt a al  laeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfr

       330       340       350       360       370       380        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
                                                            . ::::. 
------------------------------------------------------------vtswyssy
grqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgraragaffapk
© 1998-2019