Dataset for protein BCL-2-like of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mmatpasapdtrelvadfvmyklkqngyiglnlycggaglgagsggatppggrllatekeasarreigggeagtviggsa
 ahagrtsysn ai vkylgfg srkavswsqgsvvemtpteapatnrvltqymmeppsafet frrtfsdlaaqlhvtp
      mgq      m  is   r r  e dafddcaenrplrlsrgilsslsgycggrg                    
                   h                  admf erpedfihepertchp                     
                                            k  a gadn h aad                     
                                            e       a g   a                     
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------rv--pp--g--------------------------------
gaspprftqvsdelfqggpnwgrlvaffvfgaaltpdwr--ar--pi-qvqewmvayleaevpdvtasparllffaptrr
 saqq                          ingnssakttplravna           trla wih sggwele ika 
                               lsrgamshlsgsgtqke                                
                                gad vgvnpdmerlv                                 
                                  c g a keg   l                                 
                                    e         a                                 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
agpleemeapaadaimspeeeldgyepeplgkrpavlpllelvgesgnspstdgslpstpppaeeeedelyrcgsvqsle
vrem     eklkelqnev kqmnms p gnag vimsie kmeadar iyvgnv  dygat   l ahfhg    mtdc
 a                                                                          nrvt
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                             .  
----------tgakdtkpmpregatsrkaletlrrvgd-vqrrhetafqgmlsql-itp-gtayqsfeqvvnelfrdGv-
iisrylreqa----y----g-s---ps-v-q-------gfelnyrrpvsdlarkvh--nieddvkrlsr-mehvtsrspg
efgyiyslaqpylq-vsqs-q-vsv--a-s-amqqaafelnkewfsnlrscttn-dvk- ---rtl-n-p-vkepeg 
 lcdkf ghpdtghsslliappsppmavtkrv  k   s----v ptyppy-dh nlas dsr---vatms--tlq  
          aatavpragtklaigtpslhlr  e   d stsf kl kewv-- pg   fniqg t-l gis  d    
          k fpeigfddg  vrldp ad   a     h  -  d a rsig         pe  t  ada  c    
              ace   a   aa l  a                    qc                           
               aa                                   a                           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                   *            
-nWgrivaffsfggalcvesvdk------------------emqplvs---riaawmatylnrhlrpWiqenggwdt-fv
tra----tlia-eafvakhlktitawwkkrgfqprlkeqegnqevcietykplsesitev-vdtked lvkqr---gg--
pt ryva-i--y--i-i-k-lrq                  riasdgd   eyvyfvwd-i----gs yrq--  g-  t
i    r s-vv ns-r-r-y-n-                  -vsrrcr   vvrrrlvsf mnntte f--y   en  c
r    l rttt a vmseres-v                  dsrk aq   qfqllcsar etrhht  sss   ak   
          n   t laf plr                   h    g   n cgcar   agq aa  hp     e   
          e   s      gf                        a   g                  d     a   
                                                                      a         

       410       420       430       440         
....:....|....:....|....:....|....:....|....:....
                                                 
elygnna------------------rwlltg-mtvggvvllgylfs-k-
-ff----leesrrgqerfngswlsv-vf-afag--avgagvas-irr-l
k--hvedaaggiklrpl dfn a ln--t--p-va-lcet--ly--yl 
hk rpssplafw             ktvnslfvalli---isakktsc 
a  espm   a              glmiqmellgkastsf -fwqma 
    dkf                    h ha a c -lnm  h lkh  
     g                       f       aik     g   
                                       a     a   
© 1998-2019