Dataset for protein BCL-2-like of organism Loxodonta africana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                  :*            
---------------------------------------mahagrtgy--------------dnrelVmd----------
mfgfkrnaviglnlycggaglgaggcatppggrlpapgkytt------tldagrsptpavap--yri vkapigaegpdv
                                       esqvsqsylgga aamapa s  st kv rp          
                                        idcrlgvi               g a  q           
                                           efesg                    a           
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                       :    *                                   
---------------------------------------ylhykLsqrgyvwe---------ag----------------
taiparptffaptrrasppvemealaadaimspeeeldgfisev rkk--e--rlslvgens--eatgtsspstppsavn
                                        vp p qi-pa-fsqfgd e art pssdgppgmeiapgil
                                        ek   g    scp         n ageaaeleaa  l ee
                                         g          g                           
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                           :.   * .              : :.       :  *
----------dtrtsplqaspalqpalsp------vppvvhqtlrqagDefsrryrrdfsemssqlhitpgtarqrfaqV
sspsryrrsp----g----d--a-nvevsmggsgaasrplllamkrvl dve-----a-adl---vvlsnfsdqgsltt 
gndplhpqgsqpvs-ytkt-sv-dkrtki      pqkkakkn  pca n -tnhet- ---trk dvkied yti sr 
ee eaaladlpiinrssghqrtgaagag        mde ee   e   g ql f  t qg la      d  vk   
          eaaa a  e as   d f        aaa      a                a               
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    * .*  ****:*::: **. :            :     :   :.  :      *: .. **              
veelFrdG-vNWGRiVaffsFGgvlcvesvnremsplvd---nialwmteylnrhlhtWiqdngGWd-f--l--------
mnkv sg it    l tlie  aamikkllskrqevristykrvsesvavvivdttad lvssr  -r-ve-ygdgfsts
sdhe q   p       i v   ivaah krvniqsd g   qlqtfivtf etrkrp  rqq   vnttpflh  alpn
 a   e   i         a   f      de  a   e   p  s      n ee  h   eg  a fc    gf
                                          k                     ae          ee
                                                                   a            

       330       340       350     
....:....|....:....|....:....|....:
                         .         
-rel-egsw-svkt-ltgkl-vgalvtl---y---
vk-dr----w---ly-s-a-glqmclv-gqyfttk
m-r-lpyvirqtr-vv-l-vacecgilvtaw-lsr
avpfidrnglnll lfa vi    ffaek flgiq
  k fafgfil f ea   a            ah 
    e    a    a                    
© 1998-2019