Dataset for protein Mcl-1 of organism Latimeria chalumnae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               . * **   ********************************************************
--------------pstPgDG---DGDMAEFRKETLKLLRSYLCEVAGCESTETAFRFGLDQWSGGEKPLDTLRRVGDSI
gynadgsvppspptmel e  cpq                                                        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
IDKHRIAFNGMQQKLNIHKEDDLHIIPEIGNQIFKDGATNWGRIVSLIAFGAVVAKKLKKMNLEDSIEQLAVSITDFLVQ
                                                                                

       170       180       190       200       210
....:....|....:....|....:....|....:....|....:....|
**************************************************
NKGDWILKNQGWKGFVDFFHVEDAEGTIKNVLMTFAGVAGLGASLVYLMR
                                                  
© 1998-2019