Dataset for protein BCL-2-like of organism Labrus bergylta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        *              .    .   
--------------------msqnrelvvfyitykfsqrnyplnhmellepqnrtdGagagsgeeqqvlthangtfngts
mdiinmkraavsvsagvmsm---------------------------scrapsdna skmscalwketavnsrd--slcc
                  mfsysqnnvgekqmshgleksspqwyvlsmqdsgegiv rne--krpptlvalce-yldrpg
                   anmp  gi kgf h  p a g etgmgreeaedaa n dmvtt psngf rr gnas die
                     ec         c         iafed        e  l n  a  a      e    ad

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .                                                    :.    :   :    :      :
pgtppasphr--q---pa---------------------------------ttnldavkralrdsanefelryqsafsdl
tssrsspc--qq-qrl--cptggevlesdtrqlisaflrehtglskpgwnesmsaatirevaqemekqhqalfaqlaqtf
repm ht kppsetevsp                                 -saysdmhalvl vldklrya tpmitkm
q vl cl e dp sd  s                                  pdie      e aga   r  ngd ne 
d  i                                                                            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :      :    .  * ..:. **  ****: .:. * ..:.    .:      :  :                  ::
srqlhitpat---sfenVmdevfrDG-vNWGRivglfaFggalcvecvek-emsplvgri---------------aewmt
hnecgpdscsthqglrk ieslvg  hl    visfvt tavvarqlqsqedvklgldpvqgqklgqgpghcrgliqtia
ls dyl dt ayrrvss a  k  tt     aa  e   t sqy mqnqgrgsq sn                gge s
 l  rg  n  qhf ke      a                       k     thc el                     
    d          aa                                     e                         

       250       260       270       280       290       300    
....:....|....:....|....:....|....:....|....:....|....:....|....
 **      *: .:..*: * *:                .  :  .     . ..   :     
vYLdnriqpWiesqggWerFvEifgqdaagetrrsqesftkwllagmtlvtgvvvgsliaqk--
t  geekke llenda dg s f--srsvrsisqdssmkktlfavagvglasltf--ylvr-rl
d  nsplss  vk   c c lyrrqrpsavvs----- avmgl alagm a lav  t-vqa
e  lghhrd  qd     a     dvgdde fc  wptl   f  f ai   i l  rk h 
     d na                 a        r  i        a        a  i    
© 1998-2019