Dataset for protein BCL-2-like of organism Ictidomys tridecemlineatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfglkrnaviglnlycggaglgasggatppgaqllaaekeaaarreagggeaaqppsarrvarpvpigaevpdvtatpar
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                               :    *                                           
--------------------msqsnrelvvdflsykLsqkgyswsqfsdveenrteapegtesevetpsaingnpswhla
rlffaptycvsppekmeapasapdteaeldgyvpep rkrpa--------------------------------------
              maatgragmfphtiaak eghv g----vlpllelggaaakspgadgslpstpgpheeeddelyrq
                mndctfy i    q  iq   q    e dagdv a spga  gp ifs q    tpaartsppp
                h   e r      m   h                                              
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               .                  .   . . .. .    :  :     :.       :  *    * .*
dspa-n------gatghssspdar------avkqalReaGDefelryrraFsdltsqLhitpgtayqsfeqVvnelFrdG
----vvrylreqataspgekllrgevipmavlhetmfrvqkgvqrnhettlqgmlrk-dvknesdvkrltr mvhv sg 
sleiis      cgg kdagkasdsgaasrpalnva a   d stwfwpf dnfaa- -lslfd rti st seke q  
ppa pa      pqr svp  vpp      k ql   s      k lk d ae sv     ad  qg    d   e  
                  l  t k             q                d                       
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  ***.:*::: **. :            :     :   :          *: .. **                      
v-NWGRiVaffsFGgalcvesvdkemqvlvs---riaswmatylnrhlepWiqengGWdtfvelygnnaaae-r---e--
pt   hl tliv  avvakhlkninqepcigsdeqvqesitev-vdtkrd lvssr  ------f----le-s-kgq-rf
im       ile   fmvak lsrrissa e   plsyfvvd-ietr-at  hkq   ag taf-hvgd--alirlr   
           a      m   re  a   d   n  l  -af ---a-e  r    e     srenmg a       
                                  e      -  mnn h              rd             
                                                g                               

       330       340       350    
....:....|....:....|....:....|....
           *                      
nrwfltgmtvaGvvllgslfsrk-----------
ggirsv----v aagvla-----irmlsllkqyy
----n-llaft wrawe-glaylcffa k     
 nfv-krtvls kltf gvvtviae         
   dkcfepk   er    tgqg           
   a                              
© 1998-2019