Dataset for protein Bcl-w of organism Ictidomys tridecemlineatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************************************************     *:. * :    
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW-----LysrGnmgelr
                                                                aefta fgd aleaai

       170       180       190   
....:....|....:....|....:....|...
    *.* *     :*  * *            
----GnWdSv----tGkvAwG------------
rlre g a crtvla ae l alvtvgaffask
© 1998-2019