Dataset for protein BCL-2-like of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
m----rnavinrelvcggagyklsq-g-----g-----------------------------------------------
-fglk-----gln-y----hl----g-ytwpg-rllatnrtesarreigggeagaviggsagasppstltpdsrrvarpp
 ahagatgyd---i-mkyi--gagsr aerdafdvgeeekea                                      
 vdql msqsmadplvdfls l adk  scsq sdvr  m                                        
 matp erttt a  rertm   r y  v gl yca                                            
      s p      a  ve             pg                                             
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------eppgadpams------g--pepla-rpav--------------------
pigaevpdvtatparllffaptrraapleema--a----p-peseld-yt-----k----arllelvgesgnntstggsl
                               -ae-teai-gifesqpaheshhagssdpalptsp qtpaapgaaadpaa
                               lggtpasetetpgain npkwasvd s        i ggea  vi    
                                 a sgglhr g r l t      l e                      
                                        q              r                        
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                    :.     .       :      .     
---------------------------------kdtkpmgrsgatsrkaletLrrvgdgvqrryetafqgmlsqlhitpe
pstpppaeeeedelyrqsleiisrylreqatga------------------amqqaafsfslnhrrdlselsrkvdlkng
spv  vvhlpdsr   mtdcefgyiy laqdylqsvsqipqpvsppsavsrv  nihre ekev-kn adctdrfnvvsf
gls  stlt                  vngatghcsllda e igma tkq-  e   d fsaf -- kspgnn e--av
 a                           rppp                     a      t    t gywvcg -  -l
                                                                       aa      -
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
davks-fsrvmihlfsdGv-nWGRiVtlfsFggflc------------------lktvnqesc--ve---plaewmteyl
tdrqrllaq-veev-rp-ptt-----afie-eavvakhgplvtarwkkwgfqprvesirrqmaplidtykrislsiadvi
mtygt -nt ----pe-sii-   v -i-a --imier                k-ll-kdisvdcs   n-vafvssf-
--arv  ed snke -r -rr   l  -v- a a--                  - --eg-vqr -q   ev-yll-t- 
s ds-  --  d   qg            t   - l                  a eqd- --  a-   -fq---w-r 
  --   t       c             v   t                         h ee   g   q crccva  
  q                                                               a   g         
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
vrtlrdWiqkqgGWdg----------------------------------------fveff-------hvedleggir--
nnhkht-lvdnr---ttrrtpghgagraagkrprgwhgwllsllrtplfvelygpsmrplyepksgwmgfsaasesrkgq
m-qtge -rq--  va                       fchffqd fstgfwrkw-----       dnnw-alktl  
-gn-ep f--s   g-                                pla le vltktp       ----v-----  
ed-h-a  he    es                                       thnqk        tsllsttali  
 t  a-   a    an                                       qaghg        slvecvnhkh  
     s   s     k                                       g eaa        qdms niefe  
               e                                                    m g   a  c  
               c                                                    l c         
                                                                    i           

       410       420       430         
....:....|....:....|....:....|....:....
                                       
-------lvllavagv-------------vglglaylir
erfnrwfn----f---agvltgavalgalitaasl---k
       -sgmt-gacrt           -ln-a-lsr-
       ytwalwlssgk           ts-s-yfghl
        retrlimlfd           rfvpifpayc
        l gni                n-mk  kqs 
          d                  em      q 
                              k      k 
                                       
                                       
© 1998-2019