Dataset for protein BCL-2-like of organism Hippocampus comes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            .:.. :     .  : :       .                                      : : .
-----------msqnrelvlfyiryklsq----knyp--------------------------------------lnhig
msmvqptsqvlkpeskrmrp---qvgvveglmqppsapvaaastsppqlhravatlgavncnsgaakprpsaleivvqgs
              pfp ynfk ada llc k                                        ck  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:    :  :  .: .  ..     .   :  .       .   :         * : :.*.:       .:.::.  .  
lrqalnrtdgreeasgeeeqrvqtpangttng------tsppasp--------LreaasLda-------vkealrdsane
matqnqevnsdsdndvmssgdsppstpqsqpslvadgrqgvvdtetrrlirrf tdftg staswnqskaqstmkrvvtr
  sm h ned f daq l eld pd       nd l a  kg  g            a ie   h       ak

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.  .:   :..: ::* :       ** . *    . :.  ****:..*.** . :.    *:     *: : : :: **
felryshafsdldkqLhitpatayqSFenvV--devfqddvNWGRivgLfAFggalcvecmEkemiplVdriiewmtvYL
vvekhrylynnmvnk sldqrglnv  vsq aqtlfsngtt    vas v  cavvsqhlk nqrerc epvaqevst  
lld  kik  gii e    d  ddr  i e  ks  ad ni        l    i   a    gqah   l  d s  

       250       260       270       280       290       300 
....:....|....:....|....:....|....:....|....:....|....:....|.
 .* . *: .:..*: *.::*           :.:..: *:* . :.   : .:*    * 
dnHlqpWiesqggWqrFaeiFghdaaaevrrsqesfkkwLlAgvtlvtgvvvgsLiaqkRl
ls qrt lvqnns dg vqf revdp------estvrnt m fagvas--itat rlli -
     n   kh          k   l            g f      g   g a ac    
© 1998-2019