Dataset for protein BCL-2-like of organism Haplochromis burtoni

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                :  .. .         .            :              .              .    
-miyglnvtlvctypnhkltsrgy---svvvvssfhsph------dvpstkimsrngvthsaspegptqlyrrspsa---
m--nsyfrrnflkiirydhsqanvvwgprayqepssrtqgsitglnptqssvtrsgetvtgttaktkpnspvtrtqsykt
 anmmqlkniqeflme lipkn fplnhmhln gnnann gaa   eeprlkhhcr issnpdggsndh eq lqnq   
  a em  e      c        le fi  g eda  d       a g idd a  afn g   r  a c     g   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                      :        .:.    :.   :   :
-----re----------f---------l--et--l----l----t---q--pppt----esaaamrrlgwdierqhqarf
kvcmc--qsdiagrkmk-cgdsesdeq-wk--lv-aedy-sfcc-sph-aprksstdldkvlrvlkevvnevllryryay
 aird  edgslpstpe hs        er  kl ihsf g df gls pqd ha    gikkt  dtad l el ard 
                                                     e     aahe    a a f  k  p  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :   : :         .  * ..:. *   ****::.:: * ..:.               .:   .      : : :
dnlaqtllvtcgtdh-lslrkVmkelfgDg-vNWGRivslfaFggvlcvkil-----------qelgqspm-vrrlaewi
tgmssqfhlqsapaycsrfgn idsvvr hhl    vigfme tatvarec-eqkpgldprqqsne-mesyscgnivqtm
se irk sidprdeqmrfvee a       tt      a      a sqhlv           kkk rdnq  dlvsde 
nd hn     e   d q  aa                              a           e      l  a      

       250       260       270       280       290       300     
....:....|....:....|....:....|....:....|....:....|....:....|....:
: **    . *: .:..*: * ::                :  :  .     . .          
tdYLgeekkdWiqdnggWegFvefsrsarevsqdssmk--ktlfaaagvglagltfllli-----
av  nspqrs llsqda dr cklfgvq---vssriwrsihawmlvgmtvvtsvvlga--tqkrl
se  lnhlqp  vk   a a iydrdadseprc vp f kvlgl alagi a ia yrsgl  
 a  dg in                 q  aadfe  qe       f  f a    a  vla    
© 1998-2019