Dataset for protein BCL-2-like of organism Gorilla gorilla gorilla

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------fg-----------y--------------p---rlladylqyvlrqp----q----------
matpasapdtralvmtdcm--lkrnaviglnl-cggaglgagsggat-pgre-vqtgkeakaqirgygweagaviggsag
              adfveykyrqkg     ivvqwrerttmapatsydtgama--f-g-s-srkigvgdqfsqvhvtvt
                  g            m dc   pmmhtdrsrqsnq-i-vkev-f-t--ertss-la dleenr 
                                        eap pmgerhe  rma-isdtkpm-  fct     a dp 
                                             ld l        dk e  fg  e s          
                                              a          ah c  e     r          
                                                                     g          
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
asppstltpdsrrvarpppigaevaffvfgaalcaesvnkemepdvtatparllffaptrraapleemeapaadaimspe
saqqgftsvsgtpssqngnwswpl                    l gqvqewmvayle  l dwihssggwele  karv
ev eraeqepeilfqig htprla                                                        
      apamdef  g   p hh                                                         
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
eeldeeaeklkelqnevekqmgyepeplgkrpavlpllelvgesgndtstdgslpstpppaeeeedelyrsrsvqsltii
r me                 nms p gnag vimsie kmeadarsiyvgnv  dygat   l ahfhacgdrvrvesp
                                                                     g    nar  l
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------pgsgpsktsrvlrkvafs---------vgdevernlksafdnvnv---vtpdtartlfnqvmeelfrdGv-nWg
srypreqaatakpalppvqssvtarkaletlrraqrqfqkrfrrclsglvsqlh-sig-vyqs-sr-vikeper-iira-
ldtlav--t--gd-k-mg-rg-r-slvkqmwlqrlkgistsyettyrdmltsvdi---d--krte-p-nhvtsp ptt r
cqsfsgsppas--ses--pe-m-taa  deskft lrpkvghqgrwqsytrkmatrnesiv--l-t s--t qg -r   
  k  ane- gryp-ltdl-aipm     a  e   nhhld namilpwspg  nnffldqsmats lsss g  fp   
      h k fhtiafsakq ghl            d   a f i ckspi   lke   pl  d  gdd  d       
      a   eas  ed hp  dg                    d aepdg   kh    kg  a       c       
               da     a                          ac         a                   
               a                                  a                             

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                            *                   
rivtffsfggilcke---------------s--qqmaplvs---eiaywmaeylmrnlreWiqqnggwd-gfvelfg---
---alia-eaavivkgplvtarwkkwgfqplvrkeiqndedtykrlsafvttfinnhtgd lrkq----n-----y-pna
yva-i--y--f-a-h               -ln-ktivqrrciqp--esiws------es yve-r  ekt tkf-hved
 r r-vv ns-r-r-               r dy----vqprvevyv-rlvdv vdtktp f--y   g e chk ensm
 l  ttt a vmser                 krsgsdsagqgrnfrrlcsar etrhht  sss   a a  a  rtpf
      n   t laf                  l eg h edcag clcar    gq aa  hp             dg 
      e   s                      e  f     a    g               d                
                                    e                          a                
                                                                                

       410       420       430       440       450         
....:....|....:....|....:....|....:....|....:....|....:....
                                                           
-------------------wllvtgvvaglvylg-------------------------
leesrrsqllfnfswlsltff---mtlteval--sllyrktglisltvmetiantyfyf
aaggiknver d      r-agtg-li-a-ltrkrrfsclaffafk             
plafw grwm        at-esatkgv-siahikyvtvg                   
   a  lgpv        qahshrp--skm-- watpmhe                   
      k  g        n  n llmsnii s ltqkla                    
                  k    caiag f    d  g                     
                           c c                             
                             a                             
© 1998-2019