Dataset for protein Bfl1 of organism Gorilla gorilla gorilla

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFE
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************************************ :              : : 
DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWengfvkkfepksgwmtflev
                                                            gk--------------whnh
                                                                                

       170       180       190      
....:....|....:....|....:....|....:.
*  :   ::  .   .                    
Tgkivesltrkkt-yc--------------------
 pmlsimvslldrpmaltglifltvmetiantyfyf
    c l a qk  e                   
© 1998-2019