Dataset for protein BCL-2-like of organism Gallus gallus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              .  :  *                                       *                   
------msssnrelvidfvsY--------------------------------------kLsqrghcwseleeedenrtd
mamptrrfyvkynaaqgynl cgggspglvpaspageqtpppaaaapaaaaatvaevprp igsagl-aaagraeap-ap
  hegaegayv yi lk lq                                       v q----- ---------p--
         d        ih                                             yd   g drppv pa
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                       .        
taaeaemdsvlngspswh---p-------------------------paghvvngatvhrsslevheivras--------
igsg-aphapigsaaarrappdstsrpvalwspeeeldgcepeserg-g-dslp-tppelpd-ipd-lrqetlelilryl
---- -------------hr -                          - ----s------- r--l-paqp        
p pa   a  aaag  s    e                          p saaa ev paeg  s  g  p         
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   .  .**  .. .       .     .            .      
----------------------------------dvrqaLRdagdefelryrrafsgmtsqlhitp-gtayqsfeqvvne
reaageaepgvkklfpgllggpgrpgrassavmekalet  rvasgvmqkhelfvrdllrkielkkveddlravcehaeh
                                  r hlv  qi  slsr--qgdlqqfsgrgdagt fvthgvlvg mad
                                  g ah       qdqt e  aperd     s dg kcr nd  l 
                                                                        i da    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .  : *         . :            :                                 *:     **   
lfhdg-vnwGrivaffsfggalc----------vesvnkemrvlv------griaswmttyltdhldpWiqe-ngGWer-
vpnrsvtdp evrtli---afvakhvweqrccrlklidqgkqitsphrger--lvgiigeaivsskre lmslqp  lgg
r s  nl    wml--t   vmtgs        k eqprdvcqmg   edkenssy-a dpanrqvtn  dp a   dn 
k r           i e   l            a  geh lsp a      dk  tf  i  ipn ha  cd      a 
  a                                   g   l                   en  a    a        

       330       340       350       360       370
....:....|....:....|....:....|....:....|....:....|
:                        :   :         :          
fvdlygnnaa------qetfnkwlltgatvagvlllgsylsrk-------
l--ffrvedlaelrkg-ssirt--msfvgitdlgaslalmis-yrsllls
 lt-------plfdfse----nvipatsl garstrvts phswhq    
  ek erssr      wi st-q   li    iipasle g er      
       rmp       h lk           cf      f         
© 1998-2019